![]() Cholesterol derivatives of inhibitors of viral fusion
专利摘要:
公开号:AU2008314668A1 申请号:U2008314668 申请日:2008-10-20 公开日:2009-04-30 发明作者:Elisabetta Bianchi;Paolo Ingallinella;Antonello Pessi 申请人:Istituto di Ricerche di Biologia Molecolare P Angeletti SpA; IPC主号:A61K47-48
专利说明:
WO 2009/053339 PCT/EP2008/064151 1 CHOLESTEROL DERIVATIVES OF INHIBITORS OF VIRAL FUSION The present invention concerns new compounds for inhibiting viral fusion. "Enveloped viruses", such as orthomyxoviruses, paramyxoviruses, retroviruses, 5 flaviviruses, rhabdoviruses and alphaviruses, are surrounded by a lipid bilayer originating from the host plasma membrane (Ono and Freed, Adv. Virus Res., 2005, 273, 5419-5442). This envelope contains glycoproteins that mediate receptor binding and fusion between viral and host cell membranes. Cholesterol and sphingomyelin are often enriched in these viral lipid bilayers, particularly in lipid-rich rafts in their plasma membrane (Aloia et al, PNAS, 1988, 85, 900-4 and 10 1993, 90, 5181-5). In HIV- 1 the surface glycoprotein, initially synthesized as a highly glycosylated precursor, gp160, is endoproteolytically cleaved into the surface protein, gp120, that determines the viral tropism through the cellular surface receptors, and the transmembrane protein, gp4 1, which is responsible for the membrane fusion process (Moreno et al, Biochimica et Biophysica Acta, 15 2006, 1758, 111-123). Cholesterol comprises about 30% of the lipid content of the plasma membrane of mammalian cells. Cholesterol and sphingolipids in membranes are often laterally segregated from surrounding glycerolipid-rich bilayers to form membrane microdomains known as "lipid rafts" (P. Casey, Science, 1995, 268, 221-5). A number of transmembrane proteins and 20 receptors, including CD4 which is the primary receptor for HIV envelope gp120, are particularly enriched in lipid rafts. To accomplish the fusion and mixing of cellular and viral contents, gp4l must undergo a complex series of conformational changes apparently triggered by the attachment of gp120 to the CD4 primary receptor and the CCR5 or CXCR4 coreceptors of the target cell. 25 The completion of co-receptor binding leads to the fusion-active conformation of the viral transmembrane fusion protein gp41. The ectodomain of gp41 contains two heptad repeat regimes: HR1 (proximal to the N terminus) and HR2 (proximal to the C terminus). The hydrophobic fusion peptide region inserts into the host cell membrane, whereas the HR1 region of gp4l form a trimeric coiled coil structure. HR2 regions then fold back within the hydrophobic 30 grooves of the HR1 coiled coil, forming a hairpin structure containing a thermodynamically stable six-helix bundle that draws the viral and cellular membranes together for fusion (Matthews et al, Nature Reviews Drug Discovery, 2004, 3, 215-225). It has also been shown that gp41 associates with caveolin- 1, a structural protein component of a subset of lipid rafts called 'caveolae' (Hovanession et al, Immunity, 2004, 21, 617-627). 35 Caveolin-1 is a cholesterol-binding protein (Murata et al, PNAS, 1995, 92, 10339-10343), so cholesterol is enriched in caveolae, together with HIV-1. Whatever the precise mechanism, a substantial body of evidence supports the importance of lipid rafts and cholesterol in enveloped virus entry and, for HIV at least, it is generally thought WO 2009/053339 PCT/EP2008/064151 2 that the lipid rafts on host cell plasma membranes play an essential role in mediating gp 120/CD4/coreceptor interactions, while the cho lesterol/lipid rafts in HIV viral lipid bilayers are important for maintaining normal structure and function of viral glycoproteins and hence viral infectivity (Ono and Freed, supra). 5 Proteins containing lipid anchors are commonly found. One type, which has been described recently for Hedgehog proteins, involves a cholesterol molecule esterified to the C terminal amino acid of a protein following a self-splicing reaction (Tanaka Hall et al, Cell, 1997, 91, 85-97). The relative ability of lipid anchors to stably localise their associated proteins to lipid 10 membranes has been extensively studied. There is a general relationship between the degree of hydrophobic modification and the stability of membrane insertion: quasi-irreversible binding requires the presence of two long chain anchors in the molecule, for example palmitoyl and famesyl, or hexadecyl and famesyl (Barder et al, Nature, 2000, 403, 223-226). By contrast, quasi-irreversible binding is achieved with a single cholesterol moiety (Peters et al, PNAS, 2004, 15 101, 8531-6). Notably, this modification is effective for a protein (N-Ras) which is normally anchored via a different lipid. A general advantage of targeting a peptide to a membrane is to effectively increase its concentration over the bulk aqueous phase. This results in augmenting its binding affinity toward membrane-bound receptors. 20 For antiviral agents, including peptides, proteins, and antibodies, which target fusion as mechanism of action, a number of examples document the advantage of anchoring the inhibitor to a membrane. For HIV in particular, a construct, including the fusion inhibitor T20 (enfuvirtide, Fuzeon*) (Matthews et al, supra), a short linker and a transmembrane (TM) domain, was a much more powerful inhibitor than the same construct lacking the TM domain (Egelhofer 25 et al, J. Virol., 2004, 78, 568-575). Importantly, mutations in the Trp-rich region which completely inactivated the free peptide, did not reduce the potency of the membrane-anchored one (Hildinger et al, J. Virol., 2001, 75, 3038-3042). Similarly a construct including the TM domain of gp4l and the entire C-terminal heptad repeat HR2 incorporated into liposomes had potent antiviral activity (Lenz et al, J. Biol Chem., 2004, 280, 4095-4101). 30 Addition of a C-terminal octyl group to the fusion inhibitor T20 induced a significant increase in its inhibitory potency. Furthermore, octylation could rescue the activity of an otherwise inactive mutant, in which the C-terminal residues GNWF were replaced by ANAA. The mutant with a C-terminal octyl group showed potency similar to that of the wild type T20. Importantly, the position of the octyl group was critical, since N-terminal derivatization had no 35 effect on antiviral potency (Peisajovich et al, J. Biol. Chem, 2003, 278, 21012-7). An increased ability to partition into membranes has been recently proposed as the reason behind the increased clinical efficacy of the 2nd-generation inhibitor T1249 when compared with T20 (Veiga et al, J. Am. Chem. Soc, 2004, 126, 14758-63). WO 2009/053339 PCT/EP2008/064151 3 N-terminal extension of the chemokine RANTES, a natural ligand of the HIV co-receptor CCR5, with a hydrophobic group, has been used to greatly increase antiviral potency. Both the hydrophobicity and the chemical nature of the connection with the protein were important for maximal potency (Mosier et al, 1999, J. Viral, 1999, 73, 3544-50). 5 It has also been shown that when a bona fide non-neutralizing antibody, which did not inhibit HIV- 1 entry when produced as a soluble protein, was anchored to the cell surface of target cell by fusion with a transmembrane anchoring domain, it acted as a neutralizing antibody (Lee et al, J. Immunol., 2004, 173, 4618-26). In view of the above background and analysis, the present inventors proposed attaching a 10 cholesterol moiety as a lipid anchor to peptide inhibitors derived from viral fusogenic proteins. To that end cholesterol anchored HIV viral fusion inhibitors have been made which are many times more potent than any HIV fusion inhibitors previously known. Thus the present invention provides an inhibitor of viral fusion comprising at least ten contigous amino acids of the HR2 domain of a Type 1 viral fusogen protein of an enveloped 15 virus, or a derivative thereof, attached at the C-terminal to cholesterol or a derivative thereof; or a pharmaceutically acceptable salt thereof. For example, the enveloped virus may be an orthomyxovirus, paramyxovirus, retrovirus, flavivirus, rhabdovirus or alphavirus. It is believed that viral fusion in all these viruses occurs in a manner analogous to the mechanism of viral fusion in HIV-1. 20 Thus each of these viruses has an equivalent to the HR2 domain gp41 of HIV- 1 which is involved in viral fusion and can be inhibited in a manner analogous to the inhibition of HIV-I viral fusion demonstrated herein. A preferred enveloped virus is human immunodeficiency virus 1 (HIV-1). The inhibitor preferably comprises at least fifteen contiguous acids, and more preferably at 25 least twenty-five contiguous amino acids, for example more than thirty contiguous amino acids, of the HR2 domain. There may be additional natural or synthetic amino acids present in the fusogenic protein portion of the inhibitor. In particular, the HR2 domain in HIV- 1 is found in viral protein gp4 1. Using the clade B consensus numbering of Moreno et al, Biochimica et Biophysia Acta, 2006, 1758, 111-123, an 30 especially preferred contiguous series of amino acids is 628-661 of gp4l of HIV-1, also known as C34. The HR2 domain of gp41 extends from amino acids 620-663 and any contiguous sequence of at least ten amino acids from this domain may be used in the present invention. The C-terminus of the fusogenic protein may be a carboxy terminus or it may alternatively be a carboxamide, or a C1_ 6 alkyl ester optionally substituted by halogen. 35 The fusogenic protein may be directly bound to cholesterol, or a derivative thereof. Alternatively, they may be connected by a linker which comprises two or more amino acids. The amino acids may be naturally occurring or synthetic. The benefit of a linker is that it assists relative movement between the fusogenic protein and the cholesterol or derivative thereof which WO 2009/053339 PCT/EP2008/064151 4 facilitates presenting the fusogenic protein in the correct orientation for incorporation into the HR2 helix and so to disrupt viral fusion, as further described below: Thus, the linker may comprise (Gly).+ 1 , (GlySerGly), or (Gly-Pro) where n is 1 or greater, for example, 1 to 12, 1 to 6 or 1 to 4. GlySerGly is one example of a sequence of amino acids 5 which may form part of a linker. The linker may further comprise a moiety -(OCH 2 CH 2 )m- where m is from 1 to 15, for example 2 to 10, 2 to 6 or 4. Introduction of a (poly)ethyleneglycol group assists solublity in aqueous media. The final amino acid of the linker is preferably cysteine. It is generally convenient to 10 utilise the sulphur atom of cysteine to form a thioether bond with the non-amino acid portion of the linker which is then attached to the cholesterol or derivative thereof. The sulphur atom of the cysteine residue may be connected to the (poly)ethyleneglycol group by an amide moiety such as -C1_ 4 alkyleneC(O)NH- or-CI 4 alkyleneC(O)NHCi 4 alkylene such as -CH 2 C(O)NHCH 2 CH 2 -. 15 The linker may be connected to any convenient position on the cholesterol or derivative thereof In particular, connection may be via the hydroxy group of the cholesterol. Thus the linker may be connected to the cholesterol by a group -C(O)- or -C1_ 4 alkyleneC(O)-, such as CH 2 C(O)-. Examples of the non-amino acid portion of the linker are -CH 2 C(O)- and 20 -CH 2 C(O)NHCH 2 CH 2 (OCH 2 CH 2 ) 4 C(O)-. The amino acid portion of such linkers may be GlySerGlyCys where the cystene is attached to the rest of the linker via a thioether bond. It will be appreciated that numerous alterations can be made to the linker which will not affect the essential activity of the viral infusion inhibitor and such alterations fall within the scope of the present invention. 25 Particularly preferred embodiments of the invention are: 0 Ac-WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSGK NH O H SEQ ID NO.1 NH2 H 0 and H 0 0 I N O O O S Ac-WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSG, N NH 2 0 SEQ ID NO.1 30 ; and the pharmaceutically acceptable salts thereof A particular advantage conferred by the cholesterol moiety is that it increases the local concentration of the peptide portion of the molecule in the cellular component (in this case lipid WO 2009/053339 PCT/EP2008/064151 5 rafts in the host cell plasma membrane) where viral and host cell fusion take place. In addition, the cholesterol group improves the pharmacokinetic properties of the antiviral peptide. Thus the present invention also provides pharmaceutical composition comprising an inhibitor of viral fusion, as described above, and a pharmaceutically acceptable excipient. In one 5 embodiment the pharmaceutical composition is a pessary. In another embodiment it is a vaginal ring. In a further embodiment it is a cream or gel suitable for vaginal application. There is also provided an inhibitor of viral fusion as described above, for use in a method of treatment of the human body by therapy or prophylaxis. The method may be the prevention or treatment of infection by an enveloped virus, such as HIV-1 infection, or the development of 10 AIDS. Thus, there is provided the use of an inhibitor of viral fusion as described above, for the manufacture of a medicament for preventing or treating an infection by an enveloped virus, such as HIV-1, or for treating AIDS. The invention also provides a method of treating a subject prone to or suffering from 15 infection by an enveloped virus which comprises administering to that subject a prophylactically or therapeutically effective amount of an inhibitor of viral fusion as defined above. In one embodiment the method is for the prevention or treatment of infection by HIV- 1. In a further embodiment it is a method of treatment of AIDS. The invention also provides a combination of an inhibitor of viral fusion, as defined above, 20 and another compound known to treat or prevent infection by an enveloped virus, such as HIV- 1, for separate, simultaneous or sequential administration. Figure 1 shows antiviral activity against HIV- 1 (HXB2) of a peptide from the membrane proximal external region (MPER) of HIVgp41 with two lipid anchors, a Cys(cholesterol) group and a bis-Lys(N'-Palmitoyl) group, plus a control peptide where the C-terminal cysteine is 25 derivatized with iodoacetamide. The 13-aa peptide Ac-ELLELDKWASLW-NH 2 (SEQ ID NO.2) encompasses the epitope of MAb2F5. Figure 2 shows the currently accepted model for HIV fusion and for the mechanism of action of HR2 (C-domain) peptides. The Figure shows C34-chol bound to the host cell membrane in an antiparallel orientation to the HR1 (N-peptide) domain. 30 Figure 3 shows the PK of C34-cholesterol (PEP2675) given ip to mouse at 3.5mg/k. Figure 4 shows the HPLC trace of crude PEP2667 (the amino acid precursor to PEP2675) after cleavage and lyophilisation. Figure 5 shows the HPLC trace of purified PEP2667. Figure 6 shows the HPLC trace of purified C34-cholesterol. 35 Figure 7 shows antiviral activity agent HIV-1 (HXB2) of C34-chol, C34 (aceta), C34 and T20/Fuzeon*. In addition to primates, such as humans, a variety of other mammals can be treated according to the method of the present invention. For instance, mammals including, but not WO 2009/053339 PCT/EP2008/064151 6 limited to, cows, sheep, goats, horses, dogs, cats, guinea pigs, rats, or other bovine, equine, canine, feline, rodent or murine species can be treated. However, the method can also be practiced in other species such as avian species (e.g., chickens) or fish. Thus, the present invention may be used to prevent or treat diseases caused by enveloped 5 viruses such as orthomyxoviruses, paramyxoviruses, retroviruses, flaviviruses, rhabdoviruses or alphaviruses. Thus diseases that may be prevented or treated include: influenza caused by influenza A, B or C viruses or by parainfluenza virus 1-4 or by respiratory syncytial virus; mumps; measles; canine distemper virus; HIV-1 associated myelopathy, Strongyloides stercoralis hyper infection and adult T-cell leukaemia/lymphoma caused by human T-cell 10 lymphotropic virus 1, myelopathy/tropical spastic paraparesis -like neurological disease caused by human T-cell lymphotropic virus II, bovine leukaemia caused by bovine leukaemia virus; sarcomas, tumours and anaemia caused by alpharetroviruses such as Rous sarcoma virus, avian leucosis virus or avian myeloblastosis virus; mouse breast cancer caused by mouse mammary tumour virus; sarcomas and leukaemias caused by gammaretroviruses such as murine leukaemia 15 virus, feline leukaemia virus, feline sarcoma virus and reticuloendotheliosis viruses; tumours and sarcomas caused by epsilonretroviruses such as Walleye dermal sarcoma virus and Walleye epidermal hyperplasia virus 1 and 2; immune deficiency diseases caused by lentiviruses such as bovine immunodeficiency virus, HIV-1, HIV-2, simian immunodeficiency virus, feline immunodeficiency virus and swamp fever caused by equine infectious anaemia virus; yellow 20 fever; hepatitis C; bovine diarrhoea caused by bovine diarrhoea virus 1; tick-borne diseases such as Kyasanur forest disease, Omsk haemorrhagic fever, Powassan encephalitis, tick-borne encephalitis and louping-ill; dengue haemorrhagic fever; Japanese encephalitis; Murray Valley encephalitis; St Louis encephalitis; West Nile fever, meningitis and encephalitis; Classic Swine Fever; bovine ephemeral fever; rabies; Semliki Forest disease; O'nyong'nyong; Chikungunya; 25 Ross River fever; Eastern equine encephalitis; Western equine encephalitis and Venezuelan equine encephalitis; and mayaro. The present invention is further directed to the use of these compounds in the prevention or treatment of infection by a retrovirus, in particular a lentivirus such as human immunodeficiency virus (HIV) and the treatment of, and delaying of the onset of consequent pathological conditions 30 such as AIDS. Treating AIDS or preventing or treating infection by HIV is defined as including, but not limited to, treating a wide range of states of HIV infection: AIDS, ARC (AIDS related complex), both symptomatic and asymptomatic, and actual or potential exposure to HIV. For example, the compounds of this invention are useful in treating infection by HIV after suspected past exposure to HIV by, e.g., blood transfusion, organ transplant, exchange of body fluids, bites, 35 accidental needle stick, or exposure to patient blood during surgery. The term "composition" as used herein is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combination of the specified ingredients in the specified amounts. By WO 2009/053339 PCT/EP2008/064151 7 "pharmaceutically acceptable" it is meant the carrier, diluent or excipient must be compatible with the other ingredients of the formulation and not deleterious to the recipient thereof. The terms "administration of' and or "administering a" compound should be understood to mean providing a compound of the invention to the individual in need of treatment. 5 The term "subject," (alternatively referred to herein as "patient") as used herein refers to an animal, preferably a mammal, most preferably a human, who has been the object of treatment, observation or experiment. The present invention is further directed to combinations of the present compounds with one or more agents useful in the prevention or treatment of AIDS. For example, the compounds 10 of this invention may be effectively administered, whether at periods of pre-exposure and/or post-exposure, in combination with effective amounts of the antiviral agents, immunomodulators, anti-infectives, or vaccines suitable for treating HIV infection and AIDS, and known to those of ordinary skill in the art, including those listed in the following Table: 15 ANTIVIRALS Drug Name Manufacturer Indication Amprenavir Glaxo Wellcome HIV infection, AIDS, 141 W94 ARC GW 141 (protease inhibitor) Abacavir Glaxo Welcome HIV infection, AIDS, GW 1592 ARC 1592U89 (reverse transcriptase inhibitor) Acemannan Carrington Labs ARC (Irving, TX) Acyclovir Burroughs Wellcome HIV infection, AIDS, ARC, in combination with AZT AD-439 Tanox Biosystems HIV infection, AIDS, ARC AD-519 Tanox Biosystems HIV infection, AIDS, ARC Adefovir dipivoxil Gilead Sciences HIV infection AL-721 Ethigen ARC, PGL, HIV positive, (Los Angeles, CA) AIDS Alpha Interferon Glaxo Wellcome Kaposi's sarcoma, HIV, in combination w/Retrovir WO 2009/053339 PCT/EP2008/064151 8 Ansamycin Adria Laboratories ARC LM 427 (Dublin, OH) Erbamont (Stamford, CT) Antibody which Advanced Biotherapy AIDS, ARC neutralizes pH Concepts labile alpha aberrant (Rockville, MD) Interferon AR177 Aronex Pharm HIV infection, AIDS, ARC beta-fluoro-ddA Nat'l Cancer Institute AIDS-associated diseases BMS-232623 Bristol-Myers Squibb! HIV infection, AIDS, (CGP-73547) Novartis ARC (protease inhibitor) BMS-234475 Bristol-Myers Squibb! HIV infection, AIDS, (CGP-61755) Novartis ARC (protease inhibitor) CI-1012 Warner-Lambert HIV-I infection Cidofovir Gilead Science CMV retinitis, herpes, papillomavirus Curdlan sulfate AJI Pharma USA HIV infection Cytomegalovirus immune MedImmune CMV retinitis globin Cytovene Syntex sight threatening CMV Ganciclovir peripheral CMV retinitis Delaviridine Pharmacia-Upjohn HIV infection, AIDS, ARC (protease inhibitor) Dextran Sulfate Ueno Fine Chem. AIDS, ARC, HIV Ind. Ltd. (Osaka, Japan) positive asymptomatic ddC Hoffman-La Roche HIV infection, AIDS, ARC Dideoxycytidine ddl Bristol-Myers Squibb HIV infection, AIDS, ARC; Dideoxyinosine combination with AZT/d4T mozenavir AVID HIV infection, AIDS, (DMP-450) (Camden, NJ) ARC (protease inhibitor) WO 2009/053339 PCT/EP2008/064151 9 EL1O Elan Corp, PLC HIV infection (Gainesville, GA) Efavirenz DuPont (SUSTIVA@), HIV infection, AIDS, (DMP 266) Merck (STOCRIN@) ARC (-) 6-Chloro-4(S)- (non-nucleoside RT cyclopropylethynyl- inhibitor) 4(S)-trifluoro-methyl 1,4-dihydro-2H-3,1 benzoxazin-2-one, Famciclovir Smith Kline herpes zoster, herpes simplex FTC Emory University HIV infection, AIDS, ARC (reverse transcriptase inhibitor) GS 840 Gilead HIV infection, AIDS, ARC (reverse transcriptase inhibitor) HBY097 Hoechst Marion Roussel HIV infection, AIDS, ARC (non-nucleoside reverse transcriptase inhibitor) Hypericin VIMRx Pharm. HIV infection, AIDS, ARC Recombinant Human Triton Biosciences AIDS, Kaposi's sarcoma, Interferon Beta (Almeda, CA) ARC Interferon alfa-n3 Interferon Sciences ARC, AIDS Indinavir Merck HIV infection, AIDS, ARC, asymptomatic HIV positive, also in combination with AZT/ddI/ddC Compound A Merck HIV infection, AIDS, ARC, asymptomatic HIV positive Enfuvirtide Roche/Trimen's HIV infection ISIS 2922 ISIS Pharmaceuticals CMV retinitis KNI-272 Nat'l Cancer Institute HIV-assoc. diseases WO 2009/053339 PCT/EP2008/064151 10 Lamivudine, 3TC Glaxo Wellcome HIV infection, AIDS, ARC (reverse transcriptase inhibitor); also with AZT Lobucavir Bristol-Myers Squibb CMV infection Nelfinavir Agouron HIV infection, AIDS, Pharmaceuticals ARC (protease inhibitor) Nevirapine Boeheringer HIV infection, AIDS, Ingleheim ARC (protease inhibitor) Novapren Novaferon Labs, Inc. HIV inhibitor (Akron, OH) Peptide T Peninsula Labs AIDS Octapeptide (Belmont, CA) Sequence Trisodium Astra Pharm. CMV retinitis, HIV infection, Phosphonoformate Products, Inc other CMV Infections PNU-140690 Pharmacia Upjohn HIV infection, AIDS, ARC (protease inhibitor) Probucol Vyrex HIV infection, AIDS RBC-CD4 Sheffield Med. Tech HIV infection, AIDS, (Houston TX) ARC Ritonavir Abbott HIV infection, AIDS, (ABT-538) ARC (protease inhibitor) Saquinavir Hoffmann-LaRoche HIV infection, AIDS, ARC (protease inhibitor) Stavudine; d4T Bristol-Myers Squibb HIV infection, AIDS, ARC Didehydrodeoxy thymidine Valaciclovir Glaxo Wellcome genital HSV & CMV infections Virazole Viratek/ICN asymptomatic HIV Ribavirin (Costa Mesa, CA) positive, LAS, ARC VX-478 Vertex HIV infection, AIDS, ARC Zalcitabine Hoffmann-La Roche HIV infection, AIDS, ARC, with AZT WO 2009/053339 PCT/EP2008/064151 11 Zidovudine; AZT Glaxo Wellcome HIV infection, AIDS, ARC, Kaposi' s sarcoma in combination with other therapies (reverse transcriptase inhibitor) ABT-378; Lopinavir Abbott HIV infection, AIDS, ARC (protease inhibitor) ABT-378/r; contains Abbott HIV infection, AIDS, ARC lopinavir and ritonavir; (protease inhibitor) Kaletra JE2147/AG1776 Agouron HIV infection, AIDS, ARC (protease inhibitor) T-20 Trimeris HIV infection, AIDS, ARC (fusion inhibitor) T-1249 Trimeris HIV infection, AIDS, ARC (fusion inhibitor) atazanavir Bristol-Myers-Squibb HIV infection, AIDS, ARC (BMS 232632) (protease inhibitor) PRO 542 Progenics HIV infection, AIDS, ARC (attachment inhibitor) PRO 140 Progenics HIV infection, AIDS, ARC (CCR5 co-receptor inhibitor) TAK-779 Takeda HIV infection, AIDS, ARC (injectable CCR5 receptor antagonist) DPC 681 & DPC 684 DuPont HIV infection, AIDS, ARC (protease inhibitors) DPC 961 & DPC 083 DuPont HIV infection AIDS, ARC (nonnucleoside reverse transcriptase inhibitors) Trizivir (contains abacavir, GlaxoSmithKline HIV infection, AIDS, ARC lamivudine, and (reverse transcriptase zidovudine) inhibitors) tipranavir (PNU-140690) Boehringer Ingelheim HIV infection, AIDS, ARC (purchased from (protease inhibitor) Pharmacia & Upjohn) WO 2009/053339 PCT/EP2008/064151 12 tenofovir disoproxil Gilead HIV infection, AIDS, ARC fumarate (reverse transcriptase inhibitor) TMC-120 & TMC-125 Tibotec HIV infections, AIDS, ARC (non-nucleoside reverse transcriptase inhibitors) TMC-126 Tibotec HIV infection, AIDS, ARC (protease inhibitor) IMMUNO-MODULATORS Drug Name Manufacturer Indication AS-101 Wyeth-Ayerst AIDS Bropirimine Pharmacia Upjohn advanced AIDS Acemannan Carrington Labs, Inc. AIDS, ARC (Irving, TX) CL246,738 American Cyanamid AIDS, Kaposi's sarcoma Lederle Labs EL1O Elan Corp, PLC HIV infection (Gainesville, GA) FP-21399 Fuki ImmunoPharm blocks HIV fusion with CD4+ cells Gamma Interferon Genentech ARC, in combination w/TNF (tumor necrosis factor) Granulocyte Genetics Institute AIDS Macrophage Colony Sandoz Stimulating Factor Granulocyte Hoeschst-Roussel AIDS Macrophage Colony Immunex Stimulating Factor Granulocyte Schering-Plough AIDS, combination w/AZT Macrophage Colony Stimulating Factor HIV Core Particle Rorer seropositive HIV Immunostimulant WO 2009/053339 PCT/EP2008/064151 13 IL-2 Cetus AIDS, in combination Interleukin-2 w/AZT IL-2 Hoffman-La Roche AIDS, ARC, HIV, in Interleukin-2 Immunex combination w/AZT IL-2 Chiron AIDS, increase in CD4 cell Interleukin-2 counts (aldeslukin) Immune Globulin Cutter Biological pediatric AIDS, in Intravenous (Berkeley, CA) combination w/AZT (human) IMREG-1 Imreg AIDS, Kaposi's (New Orleans, LA) sarcoma, ARC, PGL IMREG-2 Imreg AIDS, Kaposi's sarcoma, (New Orleans, LA) ARC, PGL Imuthiol Diethyl Merieux Institute AIDS, ARC Dithio Carbamate Alpha-2 Schering Plough Kaposi's sarcoma w/AZT, Interferon AIDS Methionine- TNI Pharmaceutical AIDS, ARC Enkephalin (Chicago, IL) MTP-PE Ciba-Geigy Corp. Kaposi's sarcoma Muramyl-Tripeptide Granulocyte Amgen AIDS, in combination Colony Stimulating w/AZT Factor Remune Immune Response Corp. immunotherapeutic rCD4 Genentech AIDS, ARC Recombinant Soluble Human CD4 rCD4-IgG AIDS, ARC hybrids Recombinant Biogen AIDS, ARC Soluble Human CD4 Interferon Hoffman-La Roche Kaposi's sarcoma, AIDS, Alfa 2a ARC, in combination w/AZT SK&F106528 Smith Kline HIV infection Soluble 14 WO 2009/053339 PCT/EP2008/064151 14 Thymopentin Immunobiology HIV infection Research Institute Tumor Necrosis Genentech ARC, in combination Factor; TNF w/gamma Interferon etanercept Immunex Corp rheumatoid arthritis (Enbrel@) infliximab Centocor (Remicade@) rheumatoid arthritis and Crohn's disease ANTI-INFECTIVES Drug Name Manufacturer Indication Clindamycin with Pharmacia Upjohn PCP Primaquine Fluconazole Pfizer cryptococcal meningitis, candidiasis Pastille Squibb Corp. prevention of oral candidiasis Nystatin Pastille Omidyl Merrell Dow PCP Eflomithine Pentamidine LyphoMed PCP treatment Isethionate (IM & IV) (Rosemont, IL) Trimethoprim Antibacterial Trimethoprim/sulfa Antibacterial Piritrexim Burroughs Wellcome PCP treatment Pentamidine Fisons Corporation PCP prophylaxis isethionate for inhalation Spiramycin Rhone-Poulenc cryptosporidia diarrhea Intraconazole- Janssen Pharm. histoplasmosis; cryptococcal R51211 meningitis Trimetrexate Warner-Lambert PCP 5 OTHER Drug Name Manufacturer Indication WO 2009/053339 PCT/EP2008/064151 15 Daunorubicin NeXstar, Sequus Karposi's sarcoma Recombinant Human Ortho Pharm. Corp. severe anemia assoc. with Erythropoietin AZT therapy Recombinant Human Serono AIDS-related wasting, Growth Hormone cachexia Leukotriene B4 Receptor - HIV infection Antagonist Megestrol Acetate Bristol-Myers Squibb treatment of anorexia assoc. w/AIDS Soluble CD4 Protein and - HIV infection Derivatives Testosterone Alza, Smith Kline AIDS-related wasting Total Enteral Norwich Eaton diarrhea and malabsorption, Nutrition Pharmaceuticals related to AIDS It will be understood that the scope of combinations of the compounds of this invention with HI V/AIDS antivirals, immunomodulators, anti-infectives or vaccines is not limited to the list in the above Table, but includes in principle any combination with any pharmaceutical 5 composition useful for the treatment of HIV infection or AIDS. When employed in combination with the compounds of the invention, the HIV/AIDS antivirals and other agents are typically employed in their conventional dosage ranges and regimens as reported in the art, including the dosages described in the Physicians' Desk Reference, 5 4 h edition, Medical Economics Company, 2000. The dosage ranges for a compound of the invention in these combinations are the same as 10 those set forth above just before the above Table. Preferred combinations are simultaneous or alternating treatments with a compound of the present invention and an inhibitor of HIV protease and/or a non-nucleoside inhibitor of HIV reverse transcriptase. An optional fourth component in the combination is a nucleoside inhibitor of HIV reverse transcriptase, such as AZT, 3TC, ddC or dI. Preferred agents for combination 15 therapy include: Zidovudine, Lamivudine, Stavudine, Efavirenz, Ritonavir, Nelfinavir, Abacavir, Indinavir, 141-W94 (4-amino-N-((2 syn,3 S)-2-hydroxy-4-phenyl-3 -((S)-tetrahydrofuran-3 yloxycarbonylamino)-butyl)-N-isobutyl-benzenesulfonamide), N-(2(R)-hydroxy- 1 ()-indanyl) 2(R)-phenylmethyl-4-(S)-hydroxy-5 -(1 -(4-(2-benzo [b] furanylmethyl)-2(S)-N '(t-butylcarbox amido)-piperazinyl))-pentaneamide, and Delavirdine. A preferred inhibitor of HIV protease is 20 indinavir, which is the sulfate salt of N-(2(R)-hydroxy-1(S)-indanyl)-2(R)-phenylmethyl-4-(S) hydroxy-5-(1-(4-(3-pyridyl-methyl)-2(S)-N'-(t-butylcarbo-xamido)-piperazinyl))-pentane-amide ethanolate, and is synthesized according to U.S. 5,413,999. Indinavir is generally administered at a dosage of 800 mg three times a day. Other preferred inhibitors of HIV protease include WO 2009/053339 PCT/EP2008/064151 16 nelfinavir and ritonavir. Preferred non-nucleoside inhibitors of HIV reverse transcriptase include (-) 6-chloro-4(S)-cyclopropylethynyl-4(S)-trifluoromethyl-1,4-dihydro-2H-3,1-benzoxazin-2 one, which may be prepared by methods disclosed in EP 0,582,455. The preparation of ddC, ddl and AZT are also described in EPO 0,484,071. These combinations may have unexpected 5 effects on limiting the spread and degree of infection of HIV. Preferred combinations with the compounds of the present invention include the following: (1) Zidovudine and Lamivudine; (2) Stavudine and Lamivudine; (3) Efavirenz; (4) Ritoavir; (5) Nelfinavir; (6) Abacavir; (7) Indinavir; (8) 141-W94; and (9) Delavirdine. Preferred combinations with the compounds of the present invention further include the following (1) indinavir, with efavirenz or (-) 6-chloro 10 4(S)-cyclopropylethynyl-4(S)-trifluoromethyl-1,4-dihydro-2H-3,1-benzoxazin-2-one, and, optionally, AZT and/or 3TC and/or ddl and/or ddC; (2) indinavir, and any of AZT and/or ddl and/or ddC. Compound A in the foregoing Table is N-(2(R)-hydroxy- 1 (S)-indanyl)-2(R) phenylmethyl-4(S)-hydroxy-5-(1-(4-(2-benzo[b]furanylmethyl)-2(S)-N'-(t-butylcarboxamido) 15 piperazinyl))pentaneamide, preferably administered as the sulfate salt. Compound A can be prepared as described in US 5646148. In such combinations the compound of the present invention and other active agents may be administered separately or in conjunction. In addition, the administration of one element may be prior to, concurrent to, or subsequent to the administration of other agent(s). 20 One favoured combination when the enveloped virus is HIV- 1, is with enfurvirtide which is administered in a dose of from 60 to 400mg daily, for example 90mg twice daily. Enfurvirtide may be given orally as a tablet or injected subcutaneously as a 1.Oml injection. The compounds of the present invention may be administered in the form of pharmaceutically acceptable salts. The term "pharmaceutically acceptable salt" is intended to 25 include all acceptable salts such as acetate, lactobionate, benzenesulfonate, laurate, benzoate, malate, bicarbonate, maleate, bisulfate, mandelate, bitartrate, mesylate, borate, methylbromide, bromide, methylnitrate, calcium edetate, methylsulfate, camsylate, mucate, carbonate, napsylate, chloride, nitrate, clavulanate, N-methylglucamine, citrate, ammonium salt, dihydrochloride, oleate, edetate, oxalate, edisylate, pamoate (embonate), estolate, palmitate, esylate, pantothenate, 30 fumarate, phosphate/diphosphate, gluceptate, polygalacturonate, gluconate, salicylate, glutamate, stearate, glycollylarsanilate, sulfate, hexylresorcinate, subacetate, hydrabamine, succinate, hydrobromide, tannate, hydrochloride, tartrate, hydroxynaphthoate, teoclate, iodide, tosylate, isothionate, triethiodide, lactate, panoate, valerate, and the like which can be used as a dosage form for modifying the solubility or hydrolysis characteristics or can be used in sustained release 35 or pro-drug formulations. Depending on the particular functionality of the compound of the present invention, pharmaceutically acceptable salts of the compounds of this invention include those formed from cations such as sodium, potassium, aluminum, calcium, lithium, magnesium, zinc, and from bases such as ammonia, ethylenediamine, N-methyl-glutamine, lysine, arginine, WO 2009/053339 PCT/EP2008/064151 17 ornithine, choline, N,N'-dibenzylethylene-diamine, chloroprocaine, diethanolamine, procaine, N benzylphenethyl-amine, diethylamine, piperazine, tris(hydroxymethyl)aminomethane, and tetramethylammonium hydroxide. These salts may be prepared by standard procedures, e.g. by reacting a free acid with a suitable organic or inorganic base. Where a basic group is present, 5 such as amino, an acidic salt, i.e. hydrochloride, hydrobromide, acetate, pamoate, and the like, can be used as the dosage form. Also, in the case of an acid (-COOH) or alcohol group being present, pharmaceutically acceptable esters can be employed, e.g. acetate, maleate, pivaloyloxymethyl, and the like, and those esters known in the art for modifying solubility or hydrolysis characteristics for use as 10 sustained release or prodrug formulations. The compounds of the present invention may be administered by oral, parenteral (e.g., intramuscular, intraperitoneal, intravenous, ICV, intracisternal injection or infusion, subcutaneous injection, or implant), by inhalation spray, nasal, vaginal, rectal, sublingual, or topical routes of administration and may be formulated, alone or together, in suitable dosage unit 15 formulations containing conventional non-toxic pharmaceutically acceptable carriers, adjuvants and vehicles appropriate for each route of administration. In addition to the treatment of warm blooded animals such as mice, rats, horses, cattle, sheep, dogs, cats, monkeys, etc., the compounds of the invention are effective for use in humans. The pharmaceutical compositions for the administration of the compounds of this 20 invention may conveniently be presented in dosage unit form and may be prepared by any of the methods well known in the art of pharmacy. All methods include the step of bringing the active ingredient into association with the carrier which constitutes one or more accessory ingredients. In general, the pharmaceutical compositions are prepared by uniformly and intimately bringing the active ingredient into association with a liquid carrier or a finely divided solid carrier or both, 25 and then, if necessary, shaping the product into the desired formulation. In the pharmaceutical composition the active object compound is included in an amount sufficient to produce the desired effect upon the process or condition of diseases. As used herein, the term "composition" is intended to encompass a product comprising the specified ingredients in the specified amounts, as well as any product which results, directly or indirectly, from combination of the 30 specified ingredients in the specified amounts. The pharmaceutical compositions containing the active ingredient may be in a form suitable for oral use, for example, as tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules, emulsions, hard or soft capsules, or syrups or elixirs. Compositions intended for oral use may be prepared according to any method known to the art 35 for the manufacture of pharmaceutical compositions and such compositions may contain one or more agents selected from the group consisting of sweetening agents, flavoring agents, coloring agents and preserving agents in order to provide pharmaceutically elegant and palatable preparations. Tablets contain the active ingredient in admixture with non-toxic pharmaceutically WO 2009/053339 PCT/EP2008/064151 18 acceptable excipients which are suitable for the manufacture of tablets. These excipients may be for example, inert diluents, such as calcium carbonate, sodium carbonate, lactose, calcium phosphate or sodium phosphate; granulating and disintegrating agents, for example, corn starch, or alginic acid; binding agents, for example starch, gelatin or acacia, and lubricating agents, for 5 example magnesium stearate, stearic acid or talc. The tablets may be uncoated or they may be coated by known techniques to delay disintegration and absorption in the gastrointestinal tract and thereby provide a sustained action over a longer period. For example, a time delay material such as glyceryl monostearate or glyceryl distearate may be employed. They may also be coated by the techniques described in the U.S. Patents 4,256,108; 4,166,452; and 4,265,874 to form 10 osmotic therapeutic tablets for control release. Formulations for oral use may also be presented as hard gelatin capsules wherein the active ingredient is mixed with an inert solid diluent, for example, calcium carbonate, calcium phosphate or kaolin, or as soft gelatin capsules wherein the active ingredient is mixed with water or an oil medium, for example peanut oil, liquid paraffin, or olive oil. 15 Aqueous suspensions contain the active materials in admixture with excipients suitable for the manufacture of aqueous suspensions. Such excipients are suspending agents, for example sodium carboxymethylcellulose, methylcellulose, hydroxy- propylmethylcellulose, sodium alginate, polyvinyl-pyrrolidone, gum tragacanth and gum acacia; dispersing or wetting agents may be a naturally-occurring phosphatide, for example lecithin, or condensation products of an 20 alkylene oxide with fatty acids, for example polyoxyethylene stearate, or condensation products of ethylene oxide with long chain aliphatic alcohols, for example heptadecaethyleneoxycetanol, or condensation products of ethylene oxide with partial esters derived from fatty acids and a hexitol such as polyoxyethylene sorbitol monooleate, or condensation products of ethylene oxide with partial esters derived from fatty acids and hexitol anhydrides, for example polyethylene 25 sorbitan monooleate. The aqueous suspensions may also contain one or more preservatives, for example ethyl, or n-propyl, p-hydroxybenzoate, one or more coloring agents, one or more flavoring agents, and one or more sweetening agents, such as sucrose or saccharin. Oily suspensions may be formulated by suspending the active ingredient in a vegetable oil, for example arachis oil, olive oil, sesame oil or coconut oil, or in a mineral oil such as liquid 30 paraffin. The oily suspensions may contain a thickening agent, for example beeswax, hard paraffin or cetyl alcohol. Sweetening agents such as those set forth above, and flavoring agents may be added to provide a palatable oral preparation. These compositions may be preserved by the addition of an anti-oxidant such as ascorbic acid. Dispersible powders and granules suitable for preparation of an aqueous suspension by the 35 addition of water provide the active ingredient in admixture with a dispersing or wetting agent, suspending agent and one or more preservatives. Suitable dispersing or wetting agents and suspending agents are exemplified by those already mentioned above. Additional excipients, for example sweetening, flavoring and coloring agents, may also be present. WO 2009/053339 PCT/EP2008/064151 19 The pharmaceutical compositions of the invention may also be in the form of oil-in-water emulsions. The oily phase may be a vegetable oil, for example olive oil or arachis oil, or a mineral oil, for example liquid paraffin or mixtures of these. Suitable emulsifying agents may be naturally- occurring gums, for example gum acacia or gum tragacanth, naturally-occurring 5 phosphatides, for example soy bean, lecithin, and esters or partial esters derived from fatty acids and hexitol anhydrides, for example sorbitan monooleate, and condensation products of the said partial esters with ethylene oxide, for example polyoxyethylene sorbitan monooleate. The emulsions may also contain sweetening and flavoring agents. Syrups and elixirs may be formulated with sweetening agents, for example glycerol, 10 propylene glycol, sorbitol or sucrose. Such formulations may also contain a demulcent, a preservative and flavoring and coloring agents. The pharmaceutical compositions may be in the form of a sterile injectable aqueous or oleagenous suspension. This suspension may be formulated according to the known art using those suitable dispersing or wetting agents and suspending agents which have been mentioned 15 above. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally-acceptable diluent or solvent, for example as a solution in 1,3-butane diol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil may be 20 employed including synthetic mono- or diglycerides. In addition, fatty acids such as oleic acid find use in the preparation of injectables. The compounds of the present invention may also be administered in the form of suppositories for rectal administration or pessaries, rings, creams or gels for vaginal administration of the drug. These compositions can be prepared by mixing the drug with a 25 suitable non-irritating excipient which is solid at ordinary temperatures but liquid at the rectal temperature and will therefore melt in the rectum to release the drug. Such materials are cocoa butter and polyethylene glycols. For topical use, creams, ointments, jellies, solutions or suspensions, etc., containing the compounds of the present invention are employed. (For purposes of this application, topical 30 application shall include mouthwashes and gargles.) The pharmaceutical composition and method of the present invention may further comprise other therapeutically active compounds as noted herein which are usually applied in the treatment of the above mentioned pathological conditions. In the treatment or prevention of conditions caused by enveloped viruses an appropriate 35 dosage level will generally be about 0.01 to 500 mg per kg patient body weight per day which can be administered in single or multiple doses. Preferably, the dosage level will be about 0.1 to about 250 mg/kg per day; more preferably about 0.5 to about 100 mg/kg per day. A suitable dosage level may be about 0.01 to 250 mg/kg per day, about 0.05 to 100 mg/kg per day, or about WO 2009/053339 PCT/EP2008/064151 20 0.1 to 50 mg/kg per day. Within this range the dosage may be 0.05 to 0.5, 0.5 to 5 or 5 to 50 mg/kg per day. For oral, vaginal or rectal administration, the compositions are preferably provided in the form of tablets; pessaries, rings, gels or creams; or suppositories containing 1.0 to 1000 milligrams of the active ingredient per unit dose, particularly 1.0, 5.0, 10.0, 15.0. 20.0, 5 25.0, 50.0, 75.0, 100.0, 150.0, 200.0, 250.0, 300.0, 400.0, 500.0, 600.0, 750.0, 800.0, 900.0, and 1000.0 milligrams of the active ingredient for the symptomatic adjustment of the dosage to the patient to be treated. The compounds may be administered on a regimen of 1 to 4 times per day, preferably once or twice per day. It will be understood, however, that the specific dose level and frequency of dosage for any 10 particular patient may be varied and will depend upon a variety of factors including the activity of the specific compound employed, the metabolic stability and length of action of that compound, the age, body weight, general health, sex, diet, mode and time of administration, rate of excretion, drug combination, the severity of the particular condition, and the host undergoing therapy. 15 Supporting Examples Lipid-anchored peptides derived from the membrane-proximal external region (MPER) of gp4l. The antiviral activity of a peptide from the membrane-proximal external region (MPER) of 20 gp41, which also includes the epitope of monoclonal antibody (MAb) 2F5, ELLELDKWASLWNWF (SEQ ID NO.3) (IC 50 = 30 jiM) was greatly diminished by deletion of the last two C-terminal amino acids: ELLELDKWASLWN (SEQ ID NO.4) (IC 5 0 > 100 jiM), in agreement with the need for the peptide to partition into the membrane to exert its antiviral activity. Accordingly, when peptide ELLELDKWASLW (SEQ ID NO.2) (IC 50 >100 jiM) was 25 derivatized with a C-terminal cholesterol group, it regained antiviral potency (IC 50 = 5.85 piM): the cholesterol group boosted activity more than the natural three-amino acid C-terminal NWF extension. Moreover, the nature of the lipid was important, since a bis-Lys(N'-Palmitoyl) group was ineffective. The antiviral activity against HIV- 1 (HXB2) for some of these compounds is shown in Figure 1. Details of the assay used can be found in Joyce et al, J. Biol Chem., 2002, 30 277, 45811-45820. Lipid-anchored peptides derived from the C-terminal heptad repeat domain of gp4l. Peptides derived from the C-terminal heptad repeat region of gp41 are potent inhibitors of viral infectivity. Peptide T20, also known as DP-178 and now commercially as enfuvirtide/Fuzeon*, is used in the clinic for the treatment of therapy-experienced AIDS patients. T20 encompasses 35 the MPER of gp4l, thus being endowed with certain affinity for membranes. By contrast, C34 does not show any membrane tropismper se. A derivative of C34 (C34-chol) was prepared with a cholesterol group attached, via a thioether bond, to the side chain of a cysteine residue added to the C-terminus. To allow for flexibility between the lipid anchor and the C34 sequence, a Gly- WO 2009/053339 PCT/EP2008/064151 21 Ser-Gly spacer was inserted between the two. Importantly, the current model for HIV fusion indicates the need for an antiparallel arrangement of the N- and C-domain peptides (C34 is derived from the latter), and dictates that the position of a membrane anchor should be at the C terminus of C34: N-terminal derivatization would interfere with binding to the N-peptide. Figure 5 2 shows the current model for HIV fusion and the mechanism of action (MOA) of C-peptides. The figure makes immediately clear why, according to this model, the lipid anchor should be at the C-terminus of the inhibitor. Table 1 shows the sequence of C34-chol and all the control peptides, while Table 2 shows their antiviral activity in the single-cycle infectivity assay (VERTICAL). 10 Table 1. Sequence of C34-chol and controls. Peptide Sequence' C34 WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL 15 (SEQ ID NO.5) C34-Chol WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSGC(Chol) (SEQ ID NO.1) C34-Aceta WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSGC(Aceta) (SEQ ID NO.1) 20 Chol-C34 C(Chol)GSG WMEWDREINNYTSLIHSLIEESQNQQEKNEQELL (SEQ ID NO.6) C34-Pam WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSGK(Pam) (SEQ ID NO.7) 25 T20-Chol YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-GSG-C(Chol) (SEQ ID NO.8) 1 Chol, cholesterol; C(Aceta), cysteine alkylated with iodoacetamide; K(Pam), Lys(N'-palmitoyl) Antiviral potency ofpeptides derived from the C-terminal heptad repeat domain of gp4l. 30 Addition of cholesterol to C34 increases its antiviral potency 50-fold over C34 and the control peptide C34-Aceta, where the cysteine residue is alkylated with iodoacetamide. As expected, addition of cholesterol at the N-terminus instead of the C-terminus is detrimental to antiviral activity (50-fold decrease compared to underivatized C34). Also as expected, cholesterol is a much better lipid anchor than palmitic acid, since C34-Pam has comparable activity to 35 underivatized C34. Finally, addition of cholesterol is detrimental to T20, perhaps as a result of interference with its own lipophilic sequence, or because of a different MOA (25). Overall, C34-chol is -100-fold more potent than marketed fusion inhibitor enfuvirtide/Fuzeon@, and is the most potent HIV inhibitor known to date. WO 2009/053339 PCT/EP2008/064151 22 Table 2. Antiviral potency of C34-chol and controls. The antiviral potency of the peptides was determined in a single-cycle infectivity assay against HIV-HXB2. All data were from three independent experiments and expressed as mean ± SEM 5 Peptide IC 50 viral infectivity (pM) C34 205 ± 59 C34-Aceta 270 ± 88 C34-Chol 4+ 1 10 Chol-C34 9515 3172 C34-Pam 713 305 T20 692 ± 245 T20-Chol 3726 1196 15 Some of the results are also shown in Figure 7. Breadth of the antiviral response of C34-chol. When tested on a variety of viral strains, C34-chol showed widespread response with comparable IC 50 in all strains. Across the whole panel, C34-chol was ~ 50-fold more potent than underivatized or cys-alkylated C34. 20 Table 3. Antiviral potency of C34-chol and controls against multiple HIV-1 isolates. The antiviral potency of thepeptides against multiple HIV-1 isolates was determined in a single cycle infectivity assay. All data were from three independent experiments and expressed as mean SEM. VSVG is a control virus with no HIV envelope. 25 IC 50 Viral infectivity (pM)V HIV isolate C34-chol C34-Aceta C34 HXB2 8 2 227 104 141+ 59 BAL 9 5 344 82 273+ 75 NL4-3 6 2 173 20 292+ 67 30 MN-1 21 11 1003 184 866 367 89.6 34± 12 6022 480 3912 1429 R8 15 8 516 119 314+ 35 SHIVsfl62p3 9 5 1271 301 694 353 VSVG NA NA NA 35 NA, not active Accumulation of C34-chol to the target cell membrane is key to its MOA. To confirm that accumulation of the peptide to the site of action is key to the MOA of C34-chol, an experiment WO 2009/053339 PCT/EP2008/064151 23 was performed where the peptide and its controls were incubated with P4-2/R5 cells at 37 'C for 1h, followed by thorough washing to remove unbound peptide, and by addition of HIV-HXB2 to initiate infection. 5 Table 4. Antiviral potency of C34-chol is retained when pre-incubated with target cells followed by thorough wash. Antiviral potency with/without wash was determined as before. Data shown are from a single experiment, representative of three repeats. IC 50 Viral infectivity (pM) 10 Peptide No wash With wash IC 50 fold change C34-chol 7 50 7 C34-Aceta 194 109,610 565 C34 313 116,930 374 15 While the antiviral potency of underivatized and cys-alkylated C34 was decreased ~ 500 fold, C34-chol only lost 7-fold. Effect of lipid derivatization on the pharmacokinetic properties of C34-chol. In addition to providing improved antiviral potency, derivatization with cholesterol also extends the half-life of 20 the peptide in vivo. When injected intraperitoneally into the mouse at the concentration of 3.5 mg/kg, a plasma concentration of ~ 60 nM of C34-chol was still detectable after 24 h: this concentration is still > 500-fold the measured IC 50 ( 7 pM) in the single-cycle infectivity assay, as shown in Figure 3. The results obtained were: Cmax 3.1 piM, Tmax 4h, CI/F 0.60 ml/min/kg, AUC(o- 6 h) 11.5piMh. 25 Experimental details (Methods) HIV-1 Infectivity Assay (31). P4-2/R5 cells (HeLa cells expressing endogenous CXCR4 and stably transfected to express CD4 and CCR5 which also contain an integrated P-galactosidase reporter gene under control of an HIV LTR promoter) maintained in phenol red-free Dulbecco's 30 modified Eagle's medium, 10% fetal bovine serum, 1% penicillin/streptomycin were seeded in 96-well plates at 2.5 x 10 3 cells/well and infected the following day with the HXB2 strain (and a variety of other strains in some cases) of HIV-1 (Advanced Biotechnology Inc., Bethesda, MD) in the presence of titrations of the test inhibitory peptides at 37 'C. After 48 h incubation with both virus and inhibitory peptides, cells were lysed and P-galactosidase was detected using Gal 35 ScreenTM chemiluminescent substrate (Applied Biosystems, Foster City, CA) according to the manufacturer's instructions. Data were obtained using a Dynex luminometer and IC 50 values were calculated by KaleidaGraph. Although agents that block any step of the early HIV life cycle including entry, reverse transcription, integration, and tat-mediated transcription can all WO 2009/053339 PCT/EP2008/064151 24 inhibit production of P-galactosidase, C34-derived peptides are considered to act specifically at a pre-entry step by binding to HIV-1 envelope extracellularly and thus inhibiting viral entry into the host cell. In one set of experiment where the retention and functioning of three peptides (C34-Chol, 5 C34-Aceta, and C34) on target cell surface was evaluated, each peptide with proper serial dilution was pre-incubated with P4-2/R5 cells at 37 0 C for 1 h, followed by three washes with culture medium to remove unbound peptides (no wash as control) and addition of HXB2 to initiate infection. After 48 h, the antiviral activities of the residual peptides that survive the washing steps were determined by measuring the P-galactosidase activities within lysed cells as 10 described above. Synthesis of cholesterol-derivatizedpeptides. The cholesterol moiety is generally attached to the peptide via a thioether linkage with the thiol group of an extra cysteine residue, added C terminally to the gp4l sequence. 15 For both series of peptides, a thioether bond is generally used as an attachment point, since it provides both for non hydrolyzable anchoring to the membrane, and for an easy preparation of the vaccine via chemoselective methods. Chemoselective reaction between bromoacetyl groups and free thiols are described in Zeng et al, Vaccine, 2001, 19, 3843-3852. 20 Peptide -"- , Peptide- y 25 Bromoacetyl compounds can be made as described in the Examples, or by analogy, thereto, by using commercially available compounds or by well known methods from commercially available compounds. Methods of making peptides are well known in the art. Synthetic or microbiological methods can be used. 30 Derivatives of cholesterol are commercially available or can be made from commercially available materials by well known methods. The following methods illustrate the present invention. Reference Example 1 35 Synthesis of Bromoacetyl-cholesterol WO 2009/053339 PCT/EP2008/064151 25 H 0 BrH H A mixture of 100 mg of cholesterol and 40 mg of bromoacetic acid (1.1 eq) was 5 dissolved in 10 mL of anhydrous dichloromethane. Then 44 tl (1.1 eq) of DIPC (N, N diisopropylcarbodiimide) and 1.5 mg (0.05 eq) of DMAP (4-dimethylaminopyridine) were added. The solution was left stirring at room temperature for 48h and analyzed by TLC using a mixture of n-hexane/EtOAc 10/1 as solvent systems. The solvent was evaporated and the reaction product was purified by silica gel flash chromatography in n-hexane/dichloromethane 10 1/1. The fractions containing the product were pooled, evaporated and then lyophilized in water/acetonitrile 20/80. The purified product was analyzed by NMR. Yield: 73%. Reference Example 2 Synthesis of PEP2667 15 Ac-WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSGC-NH 2 (SEQ ID NO.1) Peptide PEP2667 was prepared by standard Solid-phase Peptide Synthesis, using Fmoc/t Bu chemistry on a Pioneer Peptide Synthesizer (Applied Biosystems). To produce the peptide C terminal amide, the peptide was synthesized on a Champion PEG-PS resin (Biosearch Technologies, Inc., Novato, CA) that had been previously derivatized with the Fmoc-Rink linker 20 using DIPCDI/HOBt as activators. All the acylation reactions were performed for 60 min with 4 fold excess of activated amino acid over the resin free amino groups. Amino acids were activated with equimolar amounts of HBTU (2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium hexafluorophosphate) and a 2-fold molar excess of DIEA (N,N-diisopropyl-ethylamine). The side chain protecting groups were: tert-butyl for Asp, Glu, Ser, Thr and Tyr; trityl for Asn, Cys, 25 Gln and His; tert-butoxy-carbonyl for Lys, Trp; and 2,2,4,6,7-pentamethyldihydrobenzofuran-5 sulfonyl for Arg. At the end of the assembly, the dry peptide-resin was treated with 82.5% TFA, 5% phenol, 5% water, 5% thioanisole, 2.5% ethanedithiol for 1.5h at room temperature. The resin was filtered and the solution was evaporated and the peptide pellet treated several times with 30 diethylether to remove the organic scavengers. The final pellet was dried, resuspended in 1:1 (v/v) H 2 0: acetonitrile and lyophilized. The crude peptide was analyzed by liquid chromatography-mass spectrometry using a Waters-Micromass LCZ Platform with a Phenomenex, Jupiter C 4 column (150 x 4.6 mm, 5 tn) using as eluents (A) 0.1% TFA in water and (B) 0.1% TFA in acetonitrile, and the following linear gradient: 30%(B)-60%(B) in 20'- WO 2009/053339 PCT/EP2008/064151 26 80%(B) in 3'-80%(B) for 3', flow 1 ml/min. The crude peptide was dissolved at 1 mg/ml in 70% eluent A/30% eluent B. The HPLC trace of crude PEP2667 is shown in Figure 4. The crude peptide was purified by reverse-phase HPLC with semi-preparative Waters RCM Delta-Pak TM C_4 cartridges (40 x 200 mm, 15 gm), using as eluents (A) 0.1% TFA in water 5 and (B) 0.l1% TFA in acetonitrile, and the following linear gradient: 350%(B)-5 0%(B) in 20' 80%(B) in 3'-80%(B) for 3', flow 80 ml/min. In a typical run 100 mg of crude PEP2667 were dissolved in 10 mL of 70% eluent A/30% eluent B and loaded onto the HPLC column. The HPLC profile of purified PEP2667 is shown in Figure 5 (yield 20 mg, 20%) in which the minor peak eluting at higher tR (15 min) does not represent an impurity, since it appears also in the 10 blank run. The purified peptide was characterized by HPLC/MS on a Waters-Micromass LCZ platform as described above (theoretical M.W. 4594 Da, found 4592.6 Da). Reference Example 3 15 1) NBoc-AmidoPEG 4 _acid, DIC, DMAP, DCM, 18h r.t. BocHN ' O O O 2) TFA, DCM, 3h, r.t. 3) Bromo-acetic-anhydride, DIPEA, DCM, 3h, r.t. O 0 Br_,k N H 2 O0 NBoc-AmidoPEG 4 _acid: OJ N OO OH +0H Cholest-5-en-3-yl 2,2-dimethyl-4-oxo-3,8,11,14,17-pentaoxa-5-azaicosan-20-oate (1): N-t-boc-amido-dPEG 4 T M acid (Ig, 2.7 mmol, Product N' 10220, Quanta BioDesign, Ltd.) was 20 added to a solution of cholesterol (0.99g, 2.7 mmol) in 40 mL of CH 2 Cl 2 , followed by N,N' diisopropylcarbodiimide (0.43 mL, 3.2 mmol) and 4-dimethylamino-pyridine (16 mg, 5%). The mixture was stirred at room temperature overnight and the solvent was evaporated under vacuo. The crude was dissolved in EtOAc, washed with HCl IN, saturated NH 4 Cl and brine, dried over Na 2 SO 4 , filtered and concentrated. The crude was purified by flash column chromatography WO 2009/053339 PCT/EP2008/064151 27 (BIOTAGE) on silica gel with a gradient 25-50% EtOAc in petroleum ether to afford 1.48 g of desired compound as incolor oil (Yield 75%). Cholest-5-en-3-yl 1-bromo-2-oxo-6,9,12,15-tetraoxa-3-azaoctadecan-18-oate (2): 5 Trifluoroacetic acid (2 mL, 26 mmol) was added to a solution of 1 (1.48 g, 2 mmol) in 10 ml of CH 2 Cl 2 and the mixture was stirred at room temperature for 3h. All the volatiles were removed under vacuo and the crude was lyophilized to obtain an incolor oil that was dissolved in 60 mL of CH 2 Cl 2 . Bromoacetic anhydride (0.62 g, 2.4 mmol) was added followed by NN diisopropylethylamine (0.65 mL, 3.7 mmol) and the mixture was stirred at room temperature for 10 3h. The solvent was removed under vacuo and the crude purified by flash column chromatography on silica gel (BIOTAGE) with a gradient 50-90% of EtOAc in petroleum ether to obtain 1.1 g of desired compound as a colourless oil with a yield of 74% in two steps. Example 1 15 Synthesis of (C34-Cholesterol): cholesteroylation Ac-WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSGC(Cholesteryl)-NH 2 (SEQ ID NO.1) C34-Cholesterol was prepared by chemoselective thioether conjugation between the products of Reference Examples 1 and 2 in solution. 12 mg of purified Reference Example 2 20 (2.61 [[mol) were dissolved in 600 [tL of DMSO and 1.59 mg of Reference Example 1 (3.13 [[mol, 1.2 eq), dissolved in 100 [tL of THF, were added. Then 7 [tL (1% by volume) of DIEA (N,N-diisopropyl-ethylamine) were added to the mixture which was left stirring at room temperature. The reaction was monitored by liquid chromatography-mass spectrometry using a Waters-Micromass LCZ Platform with a Phenomenex, Jupiter C 4 column (150 x 4.6 mm, 5 [tin) 25 using as eluents (A) 0.10% TFA in water and (B) 0.1% TFA in acetonitrile, and the following linear gradient: 30%(B)-70%(B) in 20'-80%(B) in 3'-80%(B) for 3', flow 1 ml/min. After lh incubation the reaction was complete and the cholesterol-peptide product was purified by reverse-phase HPLC with semi-preparative Waters RCM Delta-Pak TM C 4 cartridges (25 x 200 mm, 15 gm), using as eluents (A) 0.10% TFA in water and (B) 0.10% TFA in 30 acetonitrile, and an isocratic step at 50%(B) for 5' followed by the linear gradient: 350%(B) 50%(B) in 20'-80%(B) in 3'-80%(B) for 3', flow 30 ml/min. The purified peptide was characterized by HPLC/MS on a Waters-Micromass LCZ platform as described above but using the following linear gradient: 50%(B)-70%(B) in 20'-80%(B) in 3'-80%(B) for 3', flow 1 ml/min (theoretical M.W. 5020.0 Da, found 5020.7 Da). The HPLC profile of purified C34 35 Cholesterol is shown in Figure 6 (yield 5.7 mg, 48%): Example 2 Synthesis of C34-(Oxa 4 )-Cholesterol WO 2009/053339 PCT/EP2008/064151 28 H 0 0H II 0O0 N 0 0 0 S Ac-WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSG, N NH 2 0 5 Acetyl-WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSGC(Oxa 4 -Cholesterol) NH 2 (SEQ ID NO.1) Peptide C34-(Oxa 4 )Cholesterol was prepared by chemoselective thioether conjugation between the product of Reference Example 2 and the product of Reference Example 3 in 10 solution. 10 mg of purified Reference Example 2 (2.26 [[mol) were dissolved in 600 tL of DMSO and 1.88 mg of Reference Example 3 (2.49 [[mol, 1.1 eq), dissolved in 188 [tL of THF, were added. Then 8 [tL of DIEA (N,N-diisopropyl-ethylamine) were added to the mixture which was left stirring at room temperature. The reaction was monitored by liquid chromatography mass spectrometry using a Waters-Micromass LCZ Platform with a Phenomenex, Jupiter C 4 15 column (150 x 4.6 mm, 5 [tin) using as eluents (A) 0.1% TFA in water and (B) 0.1% TFA in acetonitrile, and the following linear gradient: 35%(B)-80%(B) in 20'-80%(B) in 3'-80%(B) for 3', flow 1 ml/min. After 3h incubation the reaction was complete and the cholesterol-peptide product was purified by reverse-phase HPLC with semi-preparative Waters RCM Delta-Pak TM C 4 cartridges 20 (25 x 200 mm, 15 gm), using as eluents (A) 0.10% TFA in water and (B) 0.10% TFA in acetonitrile, and an isocratic step at 50%(B) for 5' followed by the linear gradient: 50%(B) 70%(B) in 20'-80%(B) in 3'-80%(B) for 3', flow 30 ml/min. The purified peptide was characterized by HPLC/MS on a Waters-Micromass LCZ platform as described above but using the following linear gradient: 50%(B)-70%(B) in 20'-80%(B) in 3'-80%(B) for 3', flow 1 25 ml/min (theoretical M.W. 5268.0 Da, found 5267.7 Da). Yield: 4.7 mg.
权利要求:
Claims (27) [1] 1. An inhibitor of viral fusion comprising at least ten contiguous amino acids of the HR2 domain of a Type 1 viral fusogenic protein of an enveloped virus, or a derivative thereof, 5 attached at the C-terminal to cholesterol or a derivative thereof; or a pharmaceutically acceptable salt thereof. [2] 2. An inhibitor according to claim 1 wherein the enveloped virus is an orthomyxovirus, paramyxovirus, retrovirus, flavivirus, rhabdovirus or alphavirus. [3] 3. An inhibitor according to claim 1 or 2 wherein the virus is human immunodeficiency 10 virus 1 (HIV-1). [4] 4. An inhibitor according to any preceding claim which comprises at least 15 contiguous amino acids of the HR2 domain. [5] 5. An inhibitor according to any preceding claim which comprises at least 25 contiguous amino acids of the HR2 domain. 15 [6] 6. An inhibitor according to any preceding claim which comprises at least 30 contiguous amino acids of the HR2 domain. [7] 7. An inhibitor according to claim 6 which comprises amino acids 628-661 of gp4l of HIV 1. [8] 8. An inhibitor according to any preceding claim wherein the contiguous amino acids do not 20 extend beyond the HR2 domain. [9] 9. An inhibitor according to any preceding claim wherein the C-terminus of the viral protein is amidated. [10] 10. An inhibitor according to claim 1 having a linker between the fusogenic protein and the cholesterol or a derivative thereof, the linker comprising two or more amino acids. 25 [11] 11. An inhibitor according to claim 10 wherein the linker is (Gly) 1 +i, (GlySerGly) or (Gly Pro), wherein n is 1 or greater. [12] 12. An inhibitor according to claim 10 or 11 wherein the linker comprises GlySerGly. [13] 13. An inhibitor according to any one of claims 10 to 12 wherein the linker comprises a moiety -(OCH 2 CH 2 )m- wherein m is a integer from 1 to 15. 30 [14] 14. An inhibitor according to any one of claims 10 to 12 wherein cysteine is added to the C terminal of the amino acids of the linker. [15] 15. An inhibitor according to claim 14 wherein the linker is attached to the oxygen of the cholesterol or derivative thereof via the sulphur atom of the cysteine reside by the moiety -CH 2 C(O)- or -CH 2 C(O)NHCH 2 CH 2 (OCH 2 CH 2 ) 4 C(O)-. WO 2009/053339 PCT/EP2008/064151 30 [16] 16. An inhibitor according to any preceding claim which comprises cholesterol. [17] 17. An inhibitor according to any preceding claim which is: H 0 0 N 0 0 0 S Ac-WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSG, N NH 2 0; or SEQ ID NO.1 5 0 Ac-WMEWDREINNYTSLIHSLIEESQNQQEKNEQELLGSG§ O14A SEQ ID NO.1 NH2 O 0H or a pharmaceutically acceptable salt thereof. [18] 18. A pharmaceutical composition comprising an inhibitor of any preceding claim, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient. 10 [19] 19. A pharmaceutical composition according to claim 18 which is a pessary, vaginal ring, cream or gel. [20] 20. An inhibitor of any one of claims 1 to 17, or a pharmaceutically acceptable salt thereof, for use in a method of treatment of the human or animal body by therapy or prophylaxis. [21] 21. An inhibitor according to claim 20 wherein the therapy is the treatment or prevention of 15 infection by an enveloped virus. [22] 22. An inhibitor according to claim 21 wherein the virus is HIV-1. [23] 23. Use of a compound according to any one of claims 1 to 17, or a pharmaceutically acceptable salt thereof, for the manufacture of a medicament for treating or preventing infection by an enveloped virus. 20 [24] 24. Use according to claim 23 wherein the virus is HIV-1. [25] 25. A method of treating a subject suffering from infection by an enveloped virus which comprises administering to that subject a therapeutically effective amount of an inhibitor of claim 1, or a pharmaceutically acceptable salt thereof. [26] 26. A method of preventing a subject prone to infection by an enveloped virus from infection 25 by that virus which comprises administering to that subject a prophylactically effective amount of an inhibitor of claim 1, or a pharmaceutically acceptable salt thereof. WO 2009/053339 PCT/EP2008/064151 31 [27] 27. A combination of an inhibitor of any one of claims 1 to 17, or a pharmaceutically acceptable salt thereof, and another compound which treats or inhibits infection by an enveloped virus for simultaneous, sequential or separate administration.
类似技术:
公开号 | 公开日 | 专利标题 AU2008314668B2|2013-09-05|Cholesterol derivatives of inhibitors of viral fusion JP6567486B2|2019-08-28|Bifunctional molecules with antibody mobilization and entry inhibition activity against human immunodeficiency virus ES2231818T3|2005-05-16|BETULIN ACID DERIVATIVES AND USES FOR THE SAME. JP4625637B2|2011-02-02|Active substance delivery system and method for protecting and administering an active substance US9745334B2|2017-08-29|Cytotoxic-drug delivering molecules targeting HIV |, cytotoxic activity against the human immunodeficiency virus and methods of use NZ543122A|2008-07-31|An HIV fusion inhibitor peptide covalently linked to a blood protein US20100166806A1|2010-07-01|Combination therapy comprising the use of protein kinase C modulators and Histone Deacetylase inhibitors for treating HIV-1 latency BR112021004266A2|2021-08-03|conjugates, population of conjugates, pharmaceutical composition and methods for treating a subject with a viral infection and for prophylactic treatment WO2021046549A1|2021-03-11|Compositions and methods for the treatment of viral infections AU2020291469A1|2022-02-10|Compositions and methods for the treatment of human immunodeficiency virus JP2020517741A|2020-06-18|Lipopeptide, its derivative, its pharmaceutical composition and its use for potently inhibiting HIV US20100261876A1|2010-10-14|Novel methods of synthesis for therapeutic antiviral peptides ES2526060T3|2015-01-05|Peptide and treatment for HIV-1 infection JP2010229140A|2010-10-14|Active agent delivery system and method for protecting and administering active agent
同族专利:
公开号 | 公开日 US8629101B2|2014-01-14| EP2205283A2|2010-07-14| CA2699894C|2013-09-24| US20100305028A1|2010-12-02| EP2205283B1|2019-03-20| CA2699894A1|2009-04-30| AU2008314668B2|2013-09-05| GB0720503D0|2007-11-28| JP2011500755A|2011-01-06| CN101951958B|2013-12-04| US20140094405A1|2014-04-03| JP5537431B2|2014-07-02| JP2014111628A|2014-06-19| CN101951958A|2011-01-19| WO2009053339A3|2010-06-17| WO2009053339A2|2009-04-30|
引用文献:
公开号 | 申请日 | 公开日 | 申请人 | 专利标题 IL99843D0|1990-11-01|1992-08-18|Merck & Co Inc|Synergistic combination of hiv reverse transcriptase inhibitors| US5413999A|1991-11-08|1995-05-09|Merck & Co., Inc.|HIV protease inhibitors useful for the treatment of AIDS| IL106507A|1992-08-07|1997-11-20|Merck & Co Inc|Pharmaceutical compositions containing benzoxazinones and some novel compounds of this type| AT215952T|1993-12-15|2002-04-15|Merck & Co Inc|HIV Protease Inhibitors| ES2296665T3|1999-12-16|2008-05-01|Whitehead Institute For Biomedical Research|FIVE-HELICE PROTEIN.| EP1390399B1|2001-05-31|2005-05-11|Conjuchem, Inc.|Long lasting fusion peptide inhibitors for hiv infection| JP4332618B2|2001-09-27|2009-09-16|国立大学法人京都大学|Anti-HIV agent| AU2005231622B2|2004-04-08|2011-05-26|Jadolabs Gmbh|Tripartite conjugates containing a structure interacting with cell membrane rafts and their use| WO2006105201A2|2005-03-30|2006-10-05|Trimeris, Inc.|Conjugates comprised of fatty acid and hiv gp41-derived peptide|AT143925T|1992-04-10|1996-10-15|Schott Glaswerke|LEAD- AND BARIUM-FREE CRYSTAL GLASS WITH HIGH LIGHT TRANSMISSION| US8912322B2|2010-07-29|2014-12-16|University Of Georgia Research Foundation, Inc.|Aza-dibenzocyclooctynes and methods of making and using same| WO2012020108A2|2010-08-11|2012-02-16|Cormus Srl|Multimeric inhibitors of viral fusion and uses thereof| US9315468B2|2010-09-27|2016-04-19|University Of Georgia Research Foundation, Inc.|Methods including latent 1,3-dipole-functional compounds and materials prepared thereby| CN103122025B|2011-11-21|2017-09-05|中国人民解放军军事医学科学院毒物药物研究所|Suppress the micromolecule polypeptide conjugate of HIV| EP2794636A1|2011-12-19|2014-10-29|Janssen R&D Ireland|Hiv membrane fusion inhibitors| CN103450351B|2012-05-29|2015-04-29|中国农业大学|Long-acting polypeptide for confronting Newcastle disease virus infection and modifier thereof| CN103483428B|2012-06-11|2017-05-17|中国人民解放军军事医学科学院毒物药物研究所|Small molecule-polypeptide conjugate capable of inhibiting HIV infection| WO2015171924A2|2014-05-07|2015-11-12|Cornell University|Inhibitors of fusion between viral and cell membranes as well as compositions and methods of using them| UY36990A|2015-11-21|2017-11-30|Fundació Privada Inst De Recerca De La Sida-Caixa |DERIVATIVES OF ANTIBODIES AGAINST HIV WITH DUAL ANTIVIRAL AND IMMUNOMODULATORY ACTIVITY| AR107262A1|2016-01-27|2018-04-11|Lilly Co Eli|INACTIVATION OF PATHOGENS BY DELIPIDATION| US10887686B2|2018-08-28|2021-01-05|Ampacs Corporation|Directional microphone| WO2020139116A1|2018-12-28|2020-07-02|Общество С Ограниченной Ответственностью "Биохарт"|Recombinant inhibitor of hiv entry|
法律状态:
2014-01-16| FGA| Letters patent sealed or granted (standard patent)| 2014-07-10| PC| Assignment registered|Owner name: MSD ITALIA S.R.L. Free format text: FORMER OWNER WAS: ISTITUTO DI RICERCHE DI BIOLOGIA MOLECOLARE P. ANGELETTI S.P.A. |
优先权:
[返回顶部]
申请号 | 申请日 | 专利标题 GBGB0720503.2A|GB0720503D0|2007-10-22|2007-10-22|New compound| GB0720503.2||2007-10-22|| PCT/EP2008/064151|WO2009053339A2|2007-10-22|2008-10-20|Cholesterol derivatives of inhibitors of viral fusion| 相关专利
Sulfonates, polymers, resist compositions and patterning process
Washing machine
Washing machine
Device for fixture finishing and tension adjusting of membrane
Structure for Equipping Band in a Plane Cathode Ray Tube
Process for preparation of 7 alpha-carboxyl 9, 11-epoxy steroids and intermediates useful therein an
国家/地区
|